SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M6V750 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M6V750
Domain Number - Region: 16-40
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 0.0366
Family HIN-200/IF120x domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M6V750
Sequence length 53
Comment (tr|M6V750|M6V750_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:EMO45328.1} KW=Complete proteome OX=1049985 OS=Leptospira santarosai str. ZUN179. GN=LEP1GSC187_0900 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MDDKNQIKKTKRFVFAFFSVSILEIGLKPRFFDRRIQEYSKIRFLSFEEMCLE
Download sequence
Identical sequences A0A0E2BKB5 M5V2J1 M6K1I0 M6V750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]