SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M6XW83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M6XW83
Domain Number - Region: 197-230
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.00798
Family Probable GTPase Der, C-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M6XW83
Sequence length 240
Comment (tr|M6XW83|M6XW83_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:EMO78188.1} KW=Complete proteome OX=1193046 OS=Leptospira kirschneri str. 200801925. GN=LEP1GSC127_5085 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MAFGLYAYNQNHKPLINLFSKDVGTVFAELGTYGVKFSEIILKDEKTKTLNVNPYPIEEP
AMVEKVESTQYFEGKTGYVSPFYLLLSLDPTKEYAITGVNYTYQISCGQRCRRTVIRNFS
IDPVKSFKAFPIKTKAGEITFGGILIGKVTKTTKEDPYGIIDDTPELSEIFSGNKVSMNL
EPGEEYIKGMDSNYLRKLYYGGEVNIKNAEKLFYENLIKAYPEGYWKTLAEKKRAELGEQ
Download sequence
Identical sequences A0A0E2B5D0 M6XW83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]