SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7A6D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M7A6D2
Domain Number - Region: 129-185
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0379
Family MukF C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M7A6D2
Sequence length 193
Comment (tr|M7A6D2|M7A6D2_LEPIR) Uncharacterized protein {ECO:0000313|EMBL:EMP09525.1} KW=Complete proteome OX=1193029 OS=Leptospira interrogans serovar Pyrogenes str. 200701872. GN=LEP1GSC124_1574 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MEEQKRRKPYKTKPYELGLIAYLSGDVNNAEQLTNYLATKGLKISPRTAVAWMRIEDENG
NDWETRRALLWDKLNRKEEDMATLNIAKLRNECSDVLEGVIEDLKSAALTFKTKEGAINS
LSVIISIMHKLGSGAKWSNPIYVIQEYTNILKSIPEINRVITRNQNKIDRRIDAMFSDNE
ARAIDVTPDNQNS
Download sequence
Identical sequences M7A6D2
WP_000392459.1.34232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]