SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7BPB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7BPB1
Domain Number 1 Region: 70-117,148-181
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000798
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M7BPB1
Sequence length 300
Comment (tr|M7BPB1|M7BPB1_CHEMY) Uncharacterized protein {ECO:0000313|EMBL:EMP39746.1} KW=Complete proteome; Reference proteome OX=8469 OS=Chelonia mydas (Green sea-turtle) (Chelonia agassizi). GN=UY3_03025 OC=Chelonioidea; Cheloniidae; Chelonia.
Sequence
MASMEPAQITTAVMTILNTTCIIQQHVQNQNLQKQASRRWQRGEESDEDMDTDFSQSTGP
SCVDIMVTILDSDLKKLAIQVGVTEDHLKNKRTSEKIFKTIERKGGIEAVRKEVPMRGPE
QGSFLRLCLMLLLLQVGQQLCKVVTLTPTSPQSPNDGGIVAALKDVIQKRYKALDSSGDP
CNPYGALCPLPVVIKRSLCHRTMLETGSLTLHTSDKVNVHSLFRNLCECNQTSVIIYFNC
RGPDTKGGCGEQCKVIVGGVIVVLPPLLLRSLQSWMAGEQQLLAGHPALKAAPLPAAVQK
Download sequence
Identical sequences M7BPB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]