SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7PBA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7PBA5
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily MAL13P1.257-like 2.35e-54
Family MAL13P1.257-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M7PBA5
Sequence length 160
Comment (tr|M7PBA5|M7PBA5_PNEMU) Uncharacterized protein {ECO:0000313|EMBL:EMR11170.1} KW=Complete proteome; Reference proteome OX=1069680 OS=(Pneumocystis carinii f. sp. muris). GN=PNEG_00764 OC=Pneumocystidomycetes; Pneumocystidaceae; Pneumocystis.
Sequence
MVALGLFLSAILENITSLEPFDPQNHYYTFKVQCTSCREIHPNLVKISPRETVNIPNSRG
KASLVWKCRYCQKENSANIEEKVSQYTFEISPQESHILSFECRGCEFIEFFPDGEWCCKG
IKSGTLFRGINLIEGEWYDYDENSLNEVSITNIKWEIKRR
Download sequence
Identical sequences M7PBA5
XP_007872666.1.78607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]