SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7SYD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7SYD6
Domain Number 1 Region: 100-186
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000513
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Weak hits

Sequence:  M7SYD6
Domain Number - Region: 187-270
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0392
Family BRCA2 tower domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M7SYD6
Sequence length 288
Comment (tr|M7SYD6|M7SYD6_EUTLA) Putative ring finger protein {ECO:0000313|EMBL:EMR69327.1} KW=Complete proteome; Reference proteome OX=1287681 OS=(Eutypa armeniacae). GN=UCREL1_3647 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Diatrypaceae; Eutypa.
Sequence
MLSITTKIVAKNGSILGKIPKKSKTKMSRSSDRTYSQSQSFAGYSGVSPRASTSRVTIQS
SSARQGTGNGDAGGSADFRIVVPEGEAFFPTPKVTFLIDEPKDLICQICQSVILDMASSE
CSSSSSCSDCSACASEKGENRGRDKEKNEKAQPAILPCGHVGCYNCLTEWLTVHRACPFC
RKVMRHKDCRHTVEPRVITHDTVHALPRTTAEGGTIGHKCRECRVEDSQAKALNTWEELA
EDLRRARRQAKERGTEEAAKALKDAEKAFETAPSRAMLDKVIRVDASW
Download sequence
Identical sequences M7SYD6
XP_007791573.1.6650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]