SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M7TUP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7TUP6
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.71e-38
Family Calponin-homology domain, CH-domain 0.0000338
Further Details:      
 
Domain Number 2 Region: 167-233
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.14e-16
Family EB1 dimerisation domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M7TUP6
Sequence length 247
Comment (tr|M7TUP6|M7TUP6_BOTF1) Putative microtubule associated protein eb1 protein {ECO:0000313|EMBL:EMR84934.1} KW=Complete proteome; Reference proteome OX=1290391 OS=cinerea). GN=BcDW1_6383 OC=Helotiales; Sclerotiniaceae; Botrytis.
Sequence
MGESRQELVAWLNNLLQLNITKVEQCGTGAALCQVFDSIFLDVPMSKVKFNVNTEYAYLQ
NFKVLQNTFTRHQVDRNIHVEQLIKCKMQDNLEFLQWTKRYWDQYFPGGEYDAVARRRAA
GGPGAAPSAAPRASAGSGAARRGVTPTTTGARVAKVGAVGGGAASAALKAENDTLKETVA
GLERERDFYFSKLRDIELLVQQACEEDPEIEKQEDGLIKHIQTILYSTEDGFEIPAEAEV
DDQEETF
Download sequence
Identical sequences G2YGI3 M7TUP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]