SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9H4I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M9H4I6
Domain Number - Region: 69-116
Classification Level Classification E-value
Superfamily Coronavirus NSP7-like 0.0222
Family Coronavirus NSP7-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9H4I6
Sequence length 136
Comment (tr|M9H4I6|M9H4I6_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:EMX29986.1} KW=Complete proteome OX=1116136 OS=Escherichia coli MP021561.2. GN=ECMP0215612_3372 OC=Enterobacteriaceae; Escherichia.
Sequence
MRKILSYLKTENDIPLERVHKLIKTVLICRVGKGIPYNTGVSPAGRPLYDQFFGMLGDQN
IINTVIAMHSNEVRVNLDNKYCQQHMVSVLTLLRANARSERIQEIIDFLIANQTILHKVH
NDKRYRDLTKNHISFG
Download sequence
Identical sequences M9H4I6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]