SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9T5K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9T5K8
Domain Number 1 Region: 33-64
Classification Level Classification E-value
Superfamily Defensin-like 0.0000363
Family Defensin 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9T5K8
Sequence length 67
Comment (tr|M9T5K8|M9T5K8_9SAUR) Crotamine-Uro-1 {ECO:0000313|EMBL:AGI97143.1} OX=103697 OS=Uromastyx aegyptia. GN= OC=Toxicofera; Iguania; Acrodonta; Agamidae; Uromastycinae; Uromastyx.
Sequence
MKFLYLLCAVLFLGLLQGPGVTQAVDSYEECSRTRASACYSFLCPRGTVTIGKCSWTQKC
CQSVLGK
Download sequence
Identical sequences M9T5K8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]