SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9T7B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9T7B7
Domain Number 1 Region: 52-83
Classification Level Classification E-value
Superfamily Defensin-like 0.0000179
Family Defensin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9T7B7
Sequence length 83
Comment (tr|M9T7B7|M9T7B7_VARGA) Crotamine-Var-4 {ECO:0000313|EMBL:AGI97147.1} OX=169841 OS=Varanus glauerti (Kimberley rock monitor). GN= OC=Varanus.
Sequence
MKTLLLLCVLVFVAFQASAHPKPDEEPEPLQVADGGAPGMEGGTEMRGNSAWCGSRGGKC
YLILCPRGTGRIGKCSTMYVCCK
Download sequence
Identical sequences M9T7B7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]