SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N1JDD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1JDD3
Domain Number 1 Region: 93-230
Classification Level Classification E-value
Superfamily ISP domain 1.7e-39
Family Rieske iron-sulfur protein (ISP) 0.00000255
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 9.16e-16
Family ISP transmembrane anchor 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1JDD3
Sequence length 232
Comment (tr|N1JDD3|N1JDD3_BLUG1) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=546991 OS=(Oidium monilioides f. sp. hordei). GN=BGHDH14_bgh05800 OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MASLQRTSCGMLRTLRHRSITSIPVRTISSSVTRPEASYYESPFKGESKTTRIPNFSKYK
SATGTNSNLVFQYFMVGTMGALTAAGAKATVQDFLVNMSASADVLAMAKVEVDLAAIPQG
KNMLIKWRGKPVFIRHRTQAEIDEANSVDWEKLRDPQKDEDRTKNPEWLVMLGVCTHLGC
VPIGEAGEYGGWFCPCHGSHYDISGRIRKGPAPYNLEIPSYDFPEENSLIIG
Download sequence
Identical sequences N1JDD3
CCU75937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]