SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N2B329 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N2B329
Domain Number - Region: 17-48
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0101
Family Chicken cartilage matrix protein 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N2B329
Sequence length 112
Comment (tr|N2B329|N2B329_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EMZ34816.1} KW=Complete proteome; Reference proteome OX=97139 OS=Clostridium sp. ASF502. GN=C824_00131 OC=Clostridium.
Sequence
MNISEQVKELRYKADIFEKSGCAVDGIVKAFREAADTIETLSAKLQAANMEGIESSYGTG
WISANRPPKSNKDVLVRYNSVKMGIGWYCERSKRWWTCDGCVPVEWRPLPED
Download sequence
Identical sequences N2B329
WP_004068480.1.54735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]