SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N8PSW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N8PSW4
Domain Number - Region: 6-47
Classification Level Classification E-value
Superfamily Serum albumin-like 0.00183
Family Serum albumin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N8PSW4
Sequence length 82
Comment (tr|N8PSW4|N8PSW4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ENU29616.1} KW=Complete proteome OX=40373 OS=Acinetobacter sp. CIP-A165. GN=F991_02103 OC=Moraxellaceae; Acinetobacter.
Sequence
MNNITFVSTQEFTQAAFNQVAKIVAEHGHPCLDVCCPAESTERCLEHLAIVASDWSYDYS
FIDAHLETYKKANAEIREYLGE
Download sequence
Identical sequences N8PSW4
WP_004671098.1.83308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]