SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N8QG07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N8QG07
Domain Number - Region: 14-45
Classification Level Classification E-value
Superfamily Neurophysin II 0.0693
Family Neurophysin II 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N8QG07
Sequence length 81
Comment (tr|N8QG07|N8QG07_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ENU20239.1} KW=Complete proteome; Reference proteome OX=1217715 OS=Acinetobacter bohemicus ANC 3994. GN=F994_01297 OC=Moraxellaceae; Acinetobacter.
Sequence
MLYQYHCACCNRVVESTDKECIDCGSHNIRSPYGFWIFCILTCLAAVIVFKVVHVYLKNH
QETPVQTSLLTVLQQGESSKQ
Download sequence
Identical sequences N8QG07
WP_004651636.1.33678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]