SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N8UHR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N8UHR7
Domain Number - Region: 16-86
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 0.017
Family Functional domain of the splicing factor Prp18 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N8UHR7
Sequence length 123
Comment (tr|N8UHR7|N8UHR7_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ENU87000.1} KW=Complete proteome OX=1144664 OS=Acinetobacter sp. CIP 102129. GN=F973_00756 OC=Moraxellaceae; Acinetobacter.
Sequence
MSYYHILIEVNDHISTIEQTRDVEILDIQDISPYLHSILIPYFNEQEIELEDENVTYDEI
LHLEVKQTLLPIEHLIEEEQKQLPSDTDVTITAYEIFNDRDLSQDVTAVIFDILEAVKLD
DAP
Download sequence
Identical sequences N8UHR7
WP_004760288.1.33796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]