SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N8VM67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N8VM67
Domain Number - Region: 119-150
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.051
Family N-terminal coiled coil domain from apc 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N8VM67
Sequence length 165
Comment (tr|N8VM67|N8VM67_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ENV00586.1} KW=Complete proteome OX=1217710 OS=Acinetobacter sp. NIPH 899. GN=F969_00453 OC=Moraxellaceae; Acinetobacter.
Sequence
MNPLVPQTAGLMAVQEGIKAVSNMVSEIAHYKLAVAELEFQRKQMHEQSKIIRAEIELNH
KKEIKRIDALSSAFKTCLKHNKQFIALQKQQQDHAQEQCMMILNLIAQEQDPTNKTTLMS
LWQQILKQIELNRDETSRLNQTLMDAYHQFGIDLSRPQLDLKDVG
Download sequence
Identical sequences N8VM67
WP_004780560.1.74971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]