SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9AKW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9AKW2
Domain Number - Region: 16-83
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 0.0235
Family Functional domain of the splicing factor Prp18 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N9AKW2
Sequence length 126
Comment (tr|N9AKW2|N9AKW2_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ENV61586.1} KW=Complete proteome; Reference proteome OX=1217677 OS=Acinetobacter soli NIPH 2899. GN=F950_00864 OC=Moraxellaceae; Acinetobacter.
Sequence
MSYYHILIEVNDHISTIEQTRDIEIFDIIEIKPFLHSILLPYFNEQIIELEDENLDYQDI
LHLEVKQTLLPIKDLIEEEQKLLPSDTDVTITAYEIFNDRELSQDVTTVIMDILEAVKLD
QPPIEL
Download sequence
Identical sequences A0A0M1I552 N9AKW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]