SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9CCZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9CCZ1
Domain Number - Region: 74-119
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.0248
Family Staphylocoagulase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N9CCZ1
Sequence length 127
Comment (tr|N9CCZ1|N9CCZ1_ACIJU) Uncharacterized protein {ECO:0000313|EMBL:ENV66350.1} KW=Complete proteome OX=1217664 OS=Acinetobacter junii CIP 64.5. GN=F948_02033 OC=Moraxellaceae; Acinetobacter.
Sequence
MSQKINATDVTEEEALNAVFFERADEFIKLANEYCRPPKGQPAKPEELRGQVSAAMLFAT
ARFNTWVAANNFKNGNEMRDAKEQVMTYLLQQFQMMLEDNFDEYCEQFENYLRFRKNEDF
HAHKHDH
Download sequence
Identical sequences N9CCZ1
WP_004963285.1.73928 WP_004963285.1.92663 WP_004963285.1.99179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]