SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9FHV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9FHV1
Domain Number - Region: 36-86
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0693
Family RecG, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N9FHV1
Sequence length 113
Comment (tr|N9FHV1|N9FHV1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:ENW04476.1} KW=Complete proteome OX=1217649 OS=Acinetobacter beijerinckii ANC 3835. GN=F934_02525 OC=Moraxellaceae; Acinetobacter.
Sequence
MKVRVLKNTSYDIYDHVVKQHALIVGKEYEVLEISDSTFRLLNERKEPTLFEKNLFEITD
PAISKNWIKQEYKDGEYYITPPEFLTHRYFFEEYFDGNPDIVQQFNNYLKSIQ
Download sequence
Identical sequences N9FHV1
WP_005055290.1.30512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]