SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9UWW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N9UWW4
Domain Number 1 Region: 103-371
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.76e-44
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N9UWW4
Sequence length 377
Comment (tr|N9UWW4|N9UWW4_ENTHI) Serine/threonine protein kinase, putative {ECO:0000313|EMBL:ENY65237.1} KW=Complete proteome OX=885318 OS=Entamoeba histolytica HM-1:IMSS-A. GN=EHI7A_026460 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSTVKQIQTGYIVKEGSNVKSWKKRWFVFTTDGNISYYTNRQETCKKGEVDMRHAIKAIK
VNGKKLMIEIHFDSSRVFRLKFDDEEVEERWYKSFIEFIEDNKTSQNGFSRYEEIDLNNF
NIGNTIMQTDKGSVQTVIYTRTQIKYSMKTLLKLTLNSEEIEYIESIHNSLKLTECPYLC
RTCLSFQSENLHFVMNEYPTKKLSEIMNSSILPIPRVKFYATELLLAINALHKCNYIHME
INPETVLITDDGHIFLTTPVGLRASYKCGYNYFAPELLEKKQPTAAVDYWSYGILLFAMA
FGEAPFYDTNPSTVCKKIISEPINFPYNTFPEVESFVTELLVKDPSKRNCDFEALKLRPF
FVGINFDQFQKKEVSPQ
Download sequence
Identical sequences A0A175JWW5 C4M8K1 M2RTU9 M3TKE4 M7WVA3 N9UWW4
294381.C4M8K1 gi|56467483|gb|EAL45440.1| gi|67469697|ref|XP_650826.1| jCVI|EHI_197790 XP_650826.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]