SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O14771 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O14771
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.98e-40
Family SCAN domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.05e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 313-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.79e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 198-239
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000445
Family KRAB domain (Kruppel-associated box) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O14771
Sequence length 459
Comment (sp|O14771|ZN213_HUMAN) Zinc finger protein with KRAB and SCAN domains 21 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF213; OC=Catarrhini; Hominidae; Homo.
Sequence
MAAPLEAQDQAPGEGEGLLIVKVEDSSWEQESAQHEDGRDSEACRQRFRQFCYGDVHGPH
EAFSQLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQGWVREQHPGSGEEAVALV
EDLQKQPVKAWRQDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPAL
LKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTL
GFGLKGQSEKSLLQEMVPVVPGQTGSDVTVSWSPEEAEAWESENRPRAALGPVVGARRGR
PPTRRRQFRDLAAEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDL
VRHQGVHTGEKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCSDCGKSFSLRSYLLDHR
RVHTGERPFGCGECDKSFKQRAHLIAHQSLHAKMAQPVG
Download sequence
Identical sequences A0A0S2Z4L6 O14771
ENSP00000380087 ENSP00000459177 ENSP00000460157 gi|197383784|ref|NP_001128127.1| gi|32698678|ref|NP_004211.1| NP_001128127.1.87134 NP_001128127.1.92137 NP_004211.1.87134 NP_004211.1.92137 ENSP00000380087 ENSP00000403892 ENSP00000459177 ENSP00000460157 ENSP00000380087 9606.ENSP00000332155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]