SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P0DN42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0DN42
Domain Number 1 Region: 52-133
Classification Level Classification E-value
Superfamily Neurophysin II 1.83e-28
Family Neurophysin II 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P0DN42
Sequence length 134
Comment (sp|P0DN42|TESS_CINAN) Conophysin-like {ECO:0000303|PubMed:26025559} OX=553697 OS=Cinguloterebra anilis (Auger snail) (Triplostephanus anilis). GN= OC=Cinguloterebra.
Sequence
MKCSVLQMSRLSWTACVLLLPLLLLTLQGGVQGCFIRNCPRGGKRAVDSVQPTRQCMSCG
PEGVGQCVGPSICCGLAIGCLMGTPEAEVCQKENESSAPCAVSGRHCGMDNTGNCVADGI
CCVEDACSFNSLCR
Download sequence
Identical sequences P0DN42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]