SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P13096 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13096
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000118
Family HLH, helix-loop-helix DNA-binding domain 0.0065
Further Details:      
 
Weak hits

Sequence:  P13096
Domain Number - Region: 81-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.00128
Family Hairy Orange domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P13096
Sequence length 178
Comment (sp|P13096|ESM5_DROME) Enhancer of split m5 protein KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6096 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKA
EMLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMT
HLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW
Download sequence
Identical sequences P13096
FBpp0084352 NP_524511.1.81976 7227.FBpp0084352 FBpp0084352 FBpp0084352 FR14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]