SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P15504 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P15504
Domain Number 1 Region: 12-47
Classification Level Classification E-value
Superfamily GLA-domain 0.000000000000147
Family GLA-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P15504
Sequence length 48
Comment (sp|P15504|OSTCN_DRONO) Gamma-carboxyglutamic acid-containing protein OX=8790 OS=Dromaius novaehollandiae (Emu). GN=BGLAP; OC=Dromaius.
Sequence
SFAVGSSYGAAPDPLEAQREVCELNPDCDELADHIGFQEAYRRFYGPV
Download sequence
Identical sequences P15504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]