SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P16218 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16218
Domain Number 1 Region: 32-303
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.05e-69
Family beta-glycanases 0.0000000000535
Further Details:      
 
Domain Number 2 Region: 322-630
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.98e-66
Family beta-glycanases 0.00028
Further Details:      
 
Domain Number 3 Region: 659-820
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.86e-36
Family CBM11 0.0000000271
Further Details:      
 
Domain Number 4 Region: 827-899
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.79e-16
Family Type I dockerin domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P16218
Sequence length 900
Comment (sp|P16218|GUNH_CLOTH) Endo-1,4-beta-glucanase H KW=Complete proteome; Reference proteome OX=203119 OS=thermocellum). GN=celH; OC=Ruminiclostridium.
Sequence
MKKRLLVSFLVLSIIVGLLSFQSLGNYNSGLKIGAWVGTQPSESAIKSFQELQGRKLDIV
HQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTVDIKNGKADAYITRMAQDMKAY
GKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGATNVKWVFNVNC
DNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKPI
IIAEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYRE
AIGAGSSNPTPTPTWTSTPPSSSPKAVDPFEMVRKMGMGTNLGNTLEAPYEGSWSKSAME
YYFDDFKAAGYKNVRIPVRWDNHTMRTYPYTIDKAFLDRVEQVVDWSLSRGFVTIINSHH
DDWIKEDYNGNIERFEKIWEQIAERFKNKSENLLFEIMNEPFGNITDEQIDDMNSRILKI
IRKTNPTRIVIIGGGYWNSYNTLVNIKIPDDPYLIGTFHYYDPYEFTHKWRGTWGTQEDM
DTVVRVFDFVKSWSDRNNIPVYFGEFAVMAYADRTSRVKWYDFISDAALERGFACSVWDN
GVFGSLDNDMAIYNRDTRTFDTEILNALFNPGTYPSYSPKPSPTPRPTKPPVTPAVGEKM
LDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWL
KISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDY
QPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGATSDPTPSIKHGDLNFDNAV
NSTDLLMLKRYILKSLELGTSEQEEKFKKAADLNRDNKVDSTDLTILKRYLLKAISEIPI
Download sequence
Identical sequences H6SHY4 P16218
203119.Cthe_1472 gi|125973984|ref|YP_001037894.1| WP_011838089.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]