SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P16255 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16255
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 7.69e-58
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P16255
Sequence length 110
Comment (sp|P16255|SRP14_CANLF) Signal recognition particle 14 kDa protein KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SRP14; OC=Canis.
Sequence
MVLLESEQFLTELTRLFQKCRLSGSVFITLKKYDGRTKPIPRKGSVEGFEPSDNKCLLRA
TDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKSKSKKSKPAQ
Download sequence
Identical sequences P16255
NP_001003251.1.84170 6frk_z

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]