SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P27144 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P27144
Domain Number 1 Region: 3-126,161-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-36
Family Nucleotide and nucleoside kinases 0.00000733
Further Details:      
 
Domain Number 2 Region: 126-162
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000000366
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P27144
Sequence length 223
Comment (sp|P27144|KAD4_HUMAN) GTP:AMP phosphotransferase AK4 {ECO:0000255|HAMAP-Rule:MF_03170} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=AK3, OC=Catarrhini; Hominidae; Homo.
Sequence
MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEK
SLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLK
DRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKP
VIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Download sequence
Identical sequences P27144
gi|310110345|ref|XP_003119578.1| gi|53832001|ref|NP_982289.1| gi|53832003|ref|NP_001005353.1| gi|8051579|ref|NP_037542.1| NP_001005353.1.87134 NP_001005353.1.92137 NP_037542.1.87134 NP_037542.1.92137 NP_982289.1.87134 NP_982289.1.92137 XP_003806983.1.60992 XP_003806984.1.60992 ENSP00000322175 9606.ENSP00000294419 ENSGGOP00000027189 ENSP00000322175 ENSP00000378743 ENSP00000445912 ENSGGOP00000027189 ENSP00000322175 ENSP00000378743 ENSP00000445912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]