SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P58735 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P58735
Domain Number 1 Region: 539-566,610-690
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.87e-16
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P58735
Sequence length 704
Comment (sp|P58735|S26A1_MOUSE) Solute carrier family 26 member 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Slc26a1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDASPEPQQKGGTLVLVRRQPPVSQGLLETLKARLKKSCTCSMPCAQALVQGLFPAIHWL
PQYRLKEYLAGDVMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VNVGIFSLLCLMVGQVVDRELQLAGFDPSQDSLGPKNNDSTLNNSATTLIIGLQDCRRDC
YAIRVATALTLMAGLYQVLMGILRLGFVSTYLSQPLLDGFAMGASVTILTSQAKHMLGVQ
IPRHQGLGMVVHTWLSLLQNVGQANICDVVTSALCLGVLLAAKELSDRYRHRLKVPIPTE
LFVIVVATIVSHFGQLHTRFDSRVAGNIPTGFVAPQVPDPKIMWRVALDAMSLALVGSAF
SISLAEMFARSHGYSVSANQELLAVGCCNVLPAFFHCFATSAALSKTLVKIATGCQTQLS
SVVSAAVVLLVLLVLAPLFHDLQRCVLACIIVVSLRGALRKVKDLPQLWRLSPADALVWV
ATAATCVLVSTEAGLLAGVFFSLLSLAGRTQRPRAALLARIGDSTFYEDAAEFEGLLPPP
EVRVFRFTGPLYYANKDFFLRSLYRLTGLDAGHSATRKDQGPEVGVSNRSLVDGKDLGSV
SSGAGLVVPLAFGFHTVVIDCAPLLFLDVAGMATLKDLRRDYRALDITLLLACCSPSVRD
TLRKGGFLGEEQGAENELLFPSVHSAVEAACARREELLAADSAL
Download sequence
Identical sequences P58735 Q3UPH6
ENSMUSP00000051561 ENSMUSP00000131282 NP_001297621.1.92730 NP_777359.3.92730 XP_006534974.1.92730 XP_011247743.1.92730 XP_017176343.1.92730 XP_017176344.1.92730 XP_017176345.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]