SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P70780 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P70780
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily XisI-like 7.59e-45
Family XisI-like 0.0000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P70780
Sequence length 111
Comment (tr|P70780|P70780_9NOST) XisI {ECO:0000313|EMBL:AAB52992.1} OX=1167 OS=Anabaena sp. GN=xisI OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MAKLDEYRLKVQQILEKYAQYKPSYGDVEIELIFDTQRDHYQVISIGWNQQKRVYGPIMH
LDIRNEKIWIQQNTTEVDIAAELIEMNVPKQDIVIGFHTPKMRQMTSFSVG
Download sequence
Identical sequences A0A1Z4KU36 P70780 Q7A2F8
WP_010995632.1.33676 gi|17228955|ref|NP_485503.1| 103690.alr1462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]