SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0GU33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0GU33
Domain Number 1 Region: 285-388,495-531,703-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000346
Family ABC transporter ATPase domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 14-107,138-251
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000141
Family PHP domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0GU33
Sequence length 846
Comment (tr|Q0GU33|Q0GU33_9LACT) ORF10 {ECO:0000313|EMBL:ABG00292.1} OX=1358 OS=Lactococcus lactis. GN= OC=Lactococcus.
Sequence
MNKNRGSQFRKWVLHLHSLYSHSQLSNQYNINENNHEERFDEFLKKLNENDIKAIGLTNY
FNFSEQDYCLKRKLEEKGIVVFLNLELRLENGNVKDETCDIHIIFDNLLDEKEVKCFLAS
MTAKVVNKRLDSISSKDDYKKAVVNFDDLVKCLNDKSLNLKNRYMIGILSRGKGSSRLSS
VFEDIAERCDFFIHSSDKQKNIEEDKEYLNSHGKPLLQSSDAHSFEKIGGKFSWIKADLN
FEGLRQIMFEPSERISLGKDNPDTKLDYQVIDSIELSDARIIYLNSSLNTVIGGRSTGKS
TLTNAIAKALGNEHFVPINEKTEKGMHVFDKDIIIHWRDGQEHQDLEFLPQDYMIKIAEN
DILRNNLVRSTVKSDEGNYRKIEKYEEDTRKNQNEIDNSIQEWSNLKDKLATLIKPEGDK
KGIEVQLQKLKEQISEQEKKSDFSERKSEEYRKSETELNYYLNHQRLSEINIRNLNDMGS
IEISLSTPIPSSDDTKFRESLEEYIEVLKTEVNEKWQQKIKELTDEQNEIFSENKLKVNE
IWNSEIFKQGQTNISNNETLRKLIEIQKQEQLKLDTFIKYENNKEKIETQINEIQTKILR
SYAKFGTLREKLQNEFEVKATPVEIKINFQPIKFEEKIKYLNGRNTTNNNFIEEFDKDSF
RKIDNIFDALNLSYNQGKSQNDLIKDVLSQHWYTINYNLQYDGDNFEQMSQGKKAFVVLT
LILEFSKDKKPVIIDQPEDSLDNRAIYNDLTNYLKEKKKERQIILVTHNPNIVVGADAEN
VIVANQHSEDSPNTHGIQFDYTNGSLENTYTKSMKYTLEKQGIREHVVEILEGGKEAFEK
REKKYK
Download sequence
Identical sequences Q0GU33
gi|190571764|ref|YP_001966443.1|NC_010901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]