SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0HV38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0HV38
Domain Number 1 Region: 53-182
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 7.72e-50
Family Ecotin, trypsin inhibitor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0HV38
Sequence length 183
Comment (tr|Q0HV38|Q0HV38_SHESR) Proteinase inhibitor I11, ecotin {ECO:0000313|EMBL:ABI43017.1} KW=Complete proteome OX=60481 OS=Shewanella sp. (strain MR-7). GN=Shewmr7_2029 OC=Shewanellaceae; Shewanella.
Sequence
MKLTHVFKTAALPLAFALLSFNAAAVSPPHPTGLNAPMISIASFNHKTYAEQEATKMFPA
PEASMVQHILTLPKLENEDDYMVEIQIGQTQLVDCNKHGLNGELKELSVKGWGYSYYQVS
EVSEGPSTMMACFEMAKKEAFVRIPGELKMRYDSRLPKVFYLPEGTELRFRTWKVDSTYH
YAK
Download sequence
Identical sequences Q0HV38
WP_011626193.1.64021 60481.Shewmr7_2029 gi|114047524|ref|YP_738074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]