SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0T554 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0T554
Domain Number - Region: 82-143
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0235
Family Chemosensory protein Csp2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0T554
Sequence length 184
Comment (tr|Q0T554|Q0T554_SHIF8) Uncharacterized protein {ECO:0000313|EMBL:ABF03561.1} KW=Complete proteome OX=373384 OS=Shigella flexneri serotype 5b (strain 8401). GN=SFV_1363 OC=Enterobacteriaceae; Shigella.
Sequence
MIYPTNTGKSGEHLRLTTLESVWIQGKLRMWGRWSYIGGGKTGNMFNQLLASKKLTKTAV
NEALRRMKKAGIEKPELEAFLREMINGKQKTWLAHCTDAEALCIDRVISEVLAEHPGLIS
VLRQRYEGRGMTKRKMAELLNDAHPKWSLRTCERRIEHWLKVAEFILYKPMVMAFGIEKK
VIAF
Download sequence
Identical sequences Q0T554
WP_000640145.1.67802 gi|110805346|ref|YP_688866.1| 373384.SFV_1363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]