SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0W9Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0W9Q5
Domain Number - Region: 30-61
Classification Level Classification E-value
Superfamily Defensin-like 0.00295
Family Defensin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0W9Q5
Sequence length 65
Comment (tr|Q0W9Q5|Q0W9Q5_HORSE) Defensin like 1 {ECO:0000313|EMBL:CAJ01791.1} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=defl1 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MRFLHIFLTALFTIFQVLPDSTWALNFERPCYLRGGICLKQGTPRCEPFRGPCRAFTVCC
KIKRS
Download sequence
Identical sequences Q0W9Q5
9796.ENSECAP00000007102 ENSECAP00000007102 ENSECAP00000007102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]