SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q12P25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q12P25
Domain Number - Region: 84-107
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0102
Family Chicken cartilage matrix protein 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q12P25
Sequence length 109
Comment (tr|Q12P25|Q12P25_SHEDO) Uncharacterized protein {ECO:0000313|EMBL:ABE54801.1} KW=Complete proteome; Reference proteome OX=318161 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013). GN=Sden_1516 OC=Shewanellaceae; Shewanella.
Sequence
MSPIDQVLAAAKAIALSGHVPNLALVKSRLRNKLPIPIIIQGLKEFKAMPKECWASLADV
DLSQAEDNALQASNTDLDLQQLLLTIQQLTQQIDQLTARVQILENKVAE
Download sequence
Identical sequences Q12P25
WP_011495959.1.19895 318161.Sden_1516 gi|91792873|ref|YP_562524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]