SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q14LS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q14LS9
Domain Number - Region: 39-142
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.00497
Family Staphylocoagulase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q14LS9
Sequence length 144
Comment (tr|Q14LS9|Q14LS9_SPICI) Plectrovirus spv1-r8a2b orf 4 protein {ECO:0000313|EMBL:CAK99551.1} OX=2133 OS=Spiroplasma citri. GN=SPICI16_026 OC=Spiroplasmataceae; Spiroplasma.
Sequence
MSNFVKKNKNIENCFISKEFIPFVTEKASFINLPNHNCHIGFWLSNKFIYPSEKNSNQVA
IRLIYDNSYFIVKYDENLKRNIWKRLTGTKLINLYNQYKQNYSTNMKEALFSSEPKKVKT
NKNNLANLSVEKEEQLIKDLKSLN
Download sequence
Identical sequences Q14LS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]