SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q170N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q170N2
Domain Number 1 Region: 132-271
Classification Level Classification E-value
Superfamily Translational machinery components 1.63e-53
Family ERF1/Dom34 middle domain-like 0.0000367
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 4.19e-47
Family Dom34/Pelota N-terminal domain-like 0.00057
Further Details:      
 
Domain Number 3 Region: 265-370
Classification Level Classification E-value
Superfamily L30e-like 3.18e-33
Family ERF1/Dom34 C-terminal domain-like 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q170N2
Sequence length 386
Comment (tr|Q170N2|Q170N2_AEDAE) Protein pelota homolog {ECO:0000256|RuleBase:RU362019} KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=AAEL007854 OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MKLVHKNIDKAGDGSVVLIPEEPEDMWHAYNLIAEGDQVRSSTIRKVQNETSTGSSSSSR
VRTTLTIRVESIDFDTQAQVLRLKGRNIEENQFVKMGAYHTLDLELNRKFQLTKPEWDSI
AIERVEMACDVTQSADVAAVIMQDGLAHVCLITASMTLVRSKIDVSIPRKRKGNVQQHEK
GLAKFYDAVIQGIIRHVNFEVVKCVLIASPGFVKDQFFEYMFQQAVKTDNKVLLDNKSKF
MLVHSSSGFKHSLKEILQDPAVVAKMSDTKAAGEVKALEQFYTTLQCEPAKAFYGKKHVI
KAADGQAIETLLISDNLFRCQDVATRKEYVQLVDSVRDSGGEVKIFSSMHVSGEQLAQLT
GVAAILRFPMPELEDSEDEQSDSDSD
Download sequence
Identical sequences Q170N2
XP_021703871.1.48696 AAEL007854-PA 7159.AAEL007854-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]