SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1LFL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1LFL3
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.56e-51
Family DsbA-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q1LFL3
Sequence length 197
Comment (tr|Q1LFL3|Q1LFL3_CUPMC) 2-hydroxychromene-2-carboxylate isomerase {ECO:0000256|PIRNR:PIRNR006386} KW=Complete proteome; Reference proteome OX=266264 OS=/ CH34) (Ralstonia metallidurans). GN=Rmet_4196 OC=Burkholderiaceae; Cupriavidus.
Sequence
MNKQVEFFFDFGSPYSYLAYKELPRVAARTGATIMWRPMLLGGVFKATGNHSPAEIPAKS
KWSSGDTERWARRYDAPFRHNPFFPVNTLALMRGAIGYQRKGDAEFHRYVDAIFSAMWEH
GKNLNDPNEIGKVLVAAGFDPREALAMLDDPEVKAELKQVTEEAVARGIFGAPSFIVDGE
LFWGNDRLTFVEEQLAG
Download sequence
Identical sequences Q1LFL3
266264.Rmet_4196 gi|94313123|ref|YP_586332.1|NC_007974 WP_011518686.1.12480 WP_011518686.1.25839 gi|94313123|ref|YP_586332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]