SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1Q085 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q1Q085
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0034
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q1Q085
Sequence length 52
Comment (tr|Q1Q085|Q1Q085_KUEST) Uncharacterized protein {ECO:0000313|EMBL:CAJ72738.1} OX=174633 OS=Kuenenia stuttgartiensis. GN=kustd1993 OC=Candidatus Brocadiaceae; Candidatus Kuenenia.
Sequence
MFYKGYIITQCLIYEIPIQIRIVYFYPIIMNNFNLKMSNNAVCPKYMQNNNR
Download sequence
Identical sequences Q1Q085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]