SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1WNQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1WNQ0
Domain Number 1 Region: 36-81
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000000000000173
Family Myosin S1 fragment, N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1WNQ0
Sequence length 97
Comment (tr|Q1WNQ0|Q1WNQ0_MOUSE) Perinatal myosin heavy chain {ECO:0000313|EMBL:AAY42760.1} OX=10090 OS=Mus musculus (Mouse). GN=Myh8 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSVIQSKDGG
KVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMT
Download sequence
Identical sequences Q1WNQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]