SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q22T52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q22T52
Domain Number - Region: 21-97
Classification Level Classification E-value
Superfamily Serum albumin-like 0.00691
Family Serum albumin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q22T52
Sequence length 117
Comment (tr|Q22T52|Q22T52_TETTS) Transmembrane protein, putative {ECO:0000313|EMBL:EAR88586.1} KW=Complete proteome; Reference proteome OX=312017 OS=Tetrahymena thermophila (strain SB210). GN=TTHERM_00185600 OC=Tetrahymena.
Sequence
MKFLAASILLILLIVNVSAQTSQKVQQCTTTAENAIATLCQSGDQDCANQLLSIGNCLTT
CASGTNQSDSYVLNCAKTTCTTTNKTIQSWLNKFLSCLHIGKLSLSFLLLAIFSIVF
Download sequence
Identical sequences Q22T52
14.m00449 5911.XP_001008831 XP_001008831.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]