SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q29C82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q29C82
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 2.49e-33
Family Nucleoplasmin-like core domain 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q29C82
Sequence length 156
Comment (tr|Q29C82|Q29C82_DROPS) Uncharacterized protein {ECO:0000313|EMBL:EAL26764.2} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA20685 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAEESFYGVTLTAESNSVTWDVDEDYARGQKLVIKQILLGAEAKDNEFNVVEVNTVKDSV
QIPIAVLKAGETRAVNPDVEFYESKVTFKLIKGSGPVYIHGHNIKDDVEVVDMEEEDEED
DVAEDEEDEHPKKRAKIEQNAAAAAGDKNAKNNKKK
Download sequence
Identical sequences B4GNH0 Q29C82
7237.FBpp0283102 FBpp0283102 XP_001357630.2.19638 XP_002020484.1.64850 FBpp0178125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]