SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2B7S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q2B7S9
Domain Number - Region: 96-139
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0732
Family eIF-2-alpha, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2B7S9
Sequence length 144
Comment (tr|Q2B7S9|Q2B7S9_9BACI) Uncharacterized protein {ECO:0000313|EMBL:EAR65880.1} KW=Complete proteome OX=313627 OS=Bacillus sp. NRRL B-14911. GN=B14911_09907 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MGVLLGGCSLDENAEELYKIEQPLQAEIMLPDSFAAGEDVPIRAVLTQNGEKVAGADYVH
FEIWKRDGSVHYPMEEAADEGEGVYQLTKKFEQDGVYIIKVHASSGGSLIMPQKQFVVGE
LTEAELEELMKEGEAPSGSHEGHH
Download sequence
Identical sequences Q2B7S9
WP_009791009.1.91248 WP_009791009.1.9427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]