SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2M2I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2M2I5
Domain Number 1 Region: 373-451
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.93e-22
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 138-173
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000204
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 255-371
Classification Level Classification E-value
Superfamily Prefoldin 0.000016
Family Prefoldin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2M2I5
Sequence length 525
Comment (sp|Q2M2I5|K1C24_HUMAN) Type I keratin-24 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KRT24; OC=Catarrhini; Hominidae; Homo.
Sequence
MSCSSRASSSRAGGSSSARVSAGGSSFSSGSRCGLGGSSAQGFRGGASSCSLSGGSSGAF
GGSFGGGFGSCSVGGGFGGASGSGTGFGGGSSFGGVSGFGRGSGFCGSSRFSSGATGGFY
SYGGGMGGGVGDGGLFSGGEKQTMQNLNDRLANYLDKVRALEEANTDLENKIKEWYDKYG
PGSGDGGSGRDYSKYYSIIEDLRNQIIAATVENAGIILHIDNARLAADDFRLKYENELCL
RQSVEADINGLRKVLDDLTMTRSDLEMQIESFTEELAYLRKNHEEEMKNMQGSSGGEVTV
EMNAAPGTDLTKLLNDMRAQYEELAEQNRREAEERFNKQSASLQAQISTDAGAATSAKNE
ITELKRTLQALEIELQSQLAMKSSLEGTLADTEAGYVAQLSEIQTQISALEEEICQIWGE
TKCQNAEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRDLVSGD
SRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
Download sequence
Identical sequences Q2M2I5
ENSP00000264651 ENSP00000264651 NP_061889.2.87134 NP_061889.2.92137 9606.ENSP00000264651 gi|192807292|ref|NP_061889.2| ENSP00000264651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]