SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2NRA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2NRA1
Domain Number 1 Region: 104-266
Classification Level Classification E-value
Superfamily IpaD-like 3.79e-45
Family IpaD-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2NRA1
Sequence length 268
Comment (tr|Q2NRA1|Q2NRA1_SODGM) Uncharacterized protein {ECO:0000313|EMBL:BAE75324.1} KW=Complete proteome; Reference proteome OX=343509 OS=Sodalis glossinidius (strain morsitans). GN=SG2049 OC=Pectobacteriaceae; Sodalis.
Sequence
MINTLLSLEIRVGNLMDEGFPSVQKGKSENEMSCRYSIIMHNLKNELKEIINEYRDVGNE
FTADAGTPAHYVSSSGSVMEVLLQKLDGRRLAECPAIAADGSNLKEVKTALTASAQATYE
VVDQVKGLVRKERLNREVKLTQLQRNIDQVAAKPELRQFSCEGIQDEKQWSRYSEFWEGI
ACDIKSIKNKKEYVDFYSELTLKYTYFYQKFIELQATVAKLVKEGEDGNHVKWDAKNFQE
KFNEFKDYAKVTVVYDMPESAELKKYTI
Download sequence
Identical sequences Q2NRA1
343509.SG2049 gi|85060027|ref|YP_455729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]