SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2S3J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q2S3J8
Domain Number - Region: 5-29
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0259
Family Trimerization domain of TRAF 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q2S3J8
Sequence length 32
Comment (tr|Q2S3J8|Q2S3J8_SALRD) Uncharacterized protein {ECO:0000313|EMBL:ABC44629.1} KW=Complete proteome; Reference proteome OX=309807 OS=Salinibacter ruber (strain DSM 13855 / M31). GN=SRU_1104 OC=Rhodothermaceae; Salinibacter.
Sequence
MKEKKEKIAKLERMVGQKEVEIALLKNFLGES
Download sequence
Identical sequences Q2S3J8
YP_445233.1.20240 309807.SRU_1104 gi|83815122|ref|YP_445233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]