SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q32P86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q32P86
Domain Number - Region: 23-55
Classification Level Classification E-value
Superfamily Defensin-like 0.0183
Family Defensin 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q32P86
Sequence length 83
Comment (sp|Q32P86|DB119_BOVIN) Defensin, beta 119 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DEFB119; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKFLFLFLAILLAMEPVVSGRRHMLRCMGDLGICRPACRQSEEPYLYCRNYQPCCLPFYV
RIDISGKEGKNDWSRENRWPKVS
Download sequence
Identical sequences Q32P86
9913.ENSBTAP00000004362 ENSBTAP00000004362 ENSBTAP00000004362 NP_001095131.1.59421 NP_001095131.1.76553 XP_005887983.1.15283 XP_019828374.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]