SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3LB62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3LB62
Domain Number 1 Region: 21-121
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 9.42e-37
Family Chemosensory protein Csp2 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3LB62
Sequence length 122
Comment (tr|Q3LB62|Q3LB62_TRICA) Chemosensory protein 20 {ECO:0000313|EMBL:EFA01297.1} KW=Complete proteome; Reference proteome OX=7070 OS=Tribolium castaneum (Red flour beetle). GN=TcasGA2_TC003085 OC=Cucujiformia; Tenebrionidae; Tenebrionidae incertae sedis; Tribolium.
Sequence
MKIIILAVLIATAVAATYDVYPTKYDNVDIDAILHNKRLFDNYLQCLLKKGKCNEEAAIL
RDVIPDALITGCRKCNDHQKVSVEKVIRFLIKERNSDWQQLISVYDPKGEYQTQYAHYLE
KI
Download sequence
Identical sequences Q3LB62
TC003085 7070.Q3LB62 NP_001039277.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]