SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q485M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q485M6
Domain Number - Region: 23-56
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.0811
Family Rabenosyn-5 Rab-binding domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q485M6
Sequence length 94
Comment (tr|Q485M6|Q485M6_COLP3) Uncharacterized protein {ECO:0000313|EMBL:AAZ27495.1} KW=Complete proteome; Reference proteome OX=167879 OS=psychroerythus). GN=CPS_1497 OC=Colwelliaceae; Colwellia.
Sequence
MLIINGTAELMHDNEEFTKGTRHEFNMFSREMPFEQQLSQIEEYLVARGWDNIEVLGNGV
INNEEDITHNVLQQAYTKAKDEGLAVTVNNQPLV
Download sequence
Identical sequences Q485M6
167879.CPS_1497 gi|71281282|ref|YP_268239.1| WP_011042333.1.15195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]