SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4DFX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4DFX2
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily RmlC-like cupins 6.37e-24
Family Acireductone dioxygenase 0.00065
Further Details:      
 
Domain Number 2 Region: 200-323
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000019
Family Txnl5-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4DFX2
Sequence length 331
Comment (tr|Q4DFX2|Q4DFX2_TRYCC) Uncharacterized protein {ECO:0000313|EMBL:EAN91412.1} KW=Complete proteome; Reference proteome OX=353153 OS=Trypanosoma cruzi (strain CL Brener). GN=Tc00.1047053506367.30 OC=Schizotrypanum.
Sequence
MPGAWLLNSQEGNFKLPSHCSPDVSVPINLLEAYGVYSRMVDPATLHERHPSDDEGRTRA
QRLAWNLGYQGQEEVTLTADYQEELQEHLNLDEQMRIVESGVLYIDFRDAEERWIRVEAK
SGDLVVLPRGLYHRLVPAADSSPVKLLRLFRKSAVFQPIPRNGELSVEAAAEARAAHEDH
KFYVSHPPTETIFGPTNTEDNVLVKSPRDFDATLDKVRAQLTPGDILVLLFKGASDRRTH
QSWCPPCAAAEPIVRRAVEAAKQKRRVVYVQCNVERSVYLGNSDYAYRKHPLLNLASIPF
FLVLEQREKEVFELCRESDPGEGYNSWVEKL
Download sequence
Identical sequences Q4DFX2
gi|71649003|ref|XP_813263.1| psu|Tc00.1047053506367.30 XP_813263.1.87722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]