SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4JHT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4JHT5
Domain Number 1 Region: 71-172
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 165-210
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4JHT5
Sequence length 211
Comment (tr|Q4JHT5|Q4JHT5_HUMAN) cDNA FLJ45719 fis, clone FELNG2001953, highly similar to Suppressor of cytokine signaling 1 {ECO:0000313|EMBL:BAG54535.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_14617 OC=Catarrhini; Hominidae; Homo.
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences G3RFJ3 O15524 Q4JHT5
NP_003736.1.87134 NP_003736.1.92137 XP_018868151.1.27298 ENSP00000329418 ENSP00000329418 HR3086 gi|4507233|ref|NP_003736.1| ENSP00000329418 9606.ENSP00000329418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]